HPA017385

BMPR2 antibody from Atlas Antibodies
BMPR-II, BMPR3, BRK-3, PPH1, T-ALK
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA017385
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA017385, RRID:AB_1845397
Product name
Anti-BMPR2
Provider product page
Atlas Antibodies - HPA017385
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
PYQQDLGIGESRISHENGTILCSKGSTCYGLWEKS
KGDINLVKQGCWSHIGDPQECHYEECVVTTTPPSI
QNGTYRFCCCSTDLCNVNFTENFPPPDTTPLSPPH
SF
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -