Antibody data

Product number
H00283208-M02
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00283208-M02, RRID:AB_10759545
Product name
P4HA3 monoclonal antibody (M02), clone 7F10
Provider product page
Abnova Corporation - H00283208-M02
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant P4HA3.
Antigen sequence
TRFYDKVLSLHEDSTTPVANPLLAFTLIKRLQSDW
RNVVHSLEASENIRALKDGYEKVEQDLPAFEDLEG
AARALMRLQDVYMLNVKGLARGVFQRVTGS
Isotype
IgG
Antibody clone number
7F10
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.