HPA007897

antibody from Atlas Antibodies

Targeting: P4HA3 C-P4Halpha(III)

Antibody data

Submit

Validation data

Product number: HPA007897 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA007897, RRID:AB_2156427
Product name: Anti-P4HA3
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: TTPVANPLLAFTLIKRLQSDWRNVVHSLEASENIR ALKDGYEKVEQDLPAFEDLEGAARALMRLQDVYML NVKGLARGVFQRVTGSAITDLYSPKRLFSLTGDDC FQVGKV
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

P4HA3 protein structure - HPA007897 shown in red.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human smooth muscle shows strong cytoplasmic positivity in smooth muscle cells.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human prostate shows strong cytoplasmic positivity in smooth muscle cells.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human small intestine shows moderate cytoplasmic positivity in smooth muscle cells.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human smooth muscle shows strong cytoplasmic positivity in myocytes.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human uterus shows moderate cytoplasmic positivity in smooth muscle cells.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human pancreas shows no positivity in exocrine glandular cells as expected.
Sample type: HUMAN