HPA007897

P4HA3 antibody from Sigma-Aldrich
C-P4Halpha(III)
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA007897
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA007897, RRID:AB_2156427
Product name
Anti-P4HA3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA007897
Antibody type
Polyclonal
Antigen
Prolyl 4-hydroxylase subunit alpha-3 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
TTPVANPLLAFTLIKRLQSDWRNVVHSLEASENIR
ALKDGYEKVEQDLPAFEDLEGAARALMRLQDVYML
NVKGLARGVFQRVTGSAITDLYSPKRLFSLTGDDC
FQVGKV
Storage
-20C
Provider Type Product Number
- No reagents -