Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Immunocytochemistry [1]
- Immunohistochemistry [3]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA021400 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA021400, RRID:AB_1847197
- Product name
- Anti-CPS1
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
FKIPQKGILIGIQQSFRPRFLGVAEQLHNEGFKLF
ATEATSDWLNANNVPANPVAWPSQEGQNPSLSSIR
KLIRDGSIDLVINLPNNNTKFVHDNYVIRRTAVDS
GIPLLTNFQVTKLFAEAVQKSRKVDSKSLFHYRQY
SA- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Aberrant expression and distribution of enzymes of the urea cycle and other ammonia metabolizing pathways in dogs with congenital portosystemic shunts.
van Straten G, van Steenbeek FG, Grinwis GC, Favier RP, Kummeling A, van Gils IH, Fieten H, Groot Koerkamp MJ, Holstege FC, Rothuizen J, Spee B
PloS one 2014;9(6):e100077
PloS one 2014;9(6):e100077
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescent staining of human cell line A-431 shows localization to nucleoli.
- Sample type
- HUMAN
Enhanced validation
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Orthogonal validation
- Main image
- Experimental details
- Immunohistochemistry analysis in human liver and kidney tissues using Anti-CPS1 antibody. Corresponding CPS1 RNA-seq data are presented for the same tissues.
- Sample type
- HUMAN
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human liver shows high expression.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human kidney shows low expression as expected.
- Sample type
- HUMAN