ABIN629685

antibody from antibodies-online

Targeting: CPS1

Western blot

Immunohistochemistry

Antibody data

Submit

Validation data

Product number: ABIN629685 - Provider product page
Provider: antibodies-online
Product name: anti-Carbamoyl-Phosphate Synthase 1, Mitochondrial (CPS1) (Middle Region) antibody
Antibody type: Polyclonal
Antigen: CPS1 antibody was raised using the middle region of CPS1 corresponding to a region with amino acids YPSVTNYLYVTYNGQEHDVNFDDHGMMVLGCGPYHIGSSVEFDWCAVSSI
Description: Purified
Reactivity: Human
Host: Rabbit
Epitope: Middle Region
Vial size: 100 μg
Concentration: 1 mg/mL
Storage: Store at 2-8°C for short periods. For longer periods of storage, store at -20°C.
Handling: Avoid repeated freeze/thaw cycles. Dilute only prior to immediate use.

CPS1 protein structure - ABIN629685 shown in red.