Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00001373-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00001373-M01, RRID:AB_534823
- Product name
- CPS1 monoclonal antibody (M01), clone 8H8
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant CPS1.
- Antigen sequence
ANNVPATPVAWPSQEGQNPSLSSIRKLIRDGSIDL
VINLPNNNTKFVHDNYVIRRTAVDSGIPLLTNFQV
TKLFAEAVQKSRKVDSKSLFHYRQYSAGKAA- Isotype
- IgG
- Antibody clone number
- 8H8
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Identification of a mitochondrial defect gene signature reveals NUPR1 as a key regulator of liver cancer progression.
Lee YK, Jee BA, Kwon SM, Yoon YS, Xu WG, Wang HJ, Wang XW, Thorgeirsson SS, Lee JS, Woo HG, Yoon G
Hepatology (Baltimore, Md.) 2015 Oct;62(4):1174-89
Hepatology (Baltimore, Md.) 2015 Oct;62(4):1174-89
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- CPS1 monoclonal antibody (M01), clone 8H8 Western Blot analysis of CPS1 expression in HeLa ( Cat # L013V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged CPS1 is approximately 0.03ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoperoxidase of monoclonal antibody to CPS1 on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol