Antibody data

Product number
H00002946-M03
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00002946-M03, RRID:AB_1575337
Product name
GSTM2 monoclonal antibody (M03), clone 1E10
Provider product page
Abnova Corporation - H00002946-M03
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant GSTM2.
Antigen sequence
SEKEQIREDILENQFMDSRMQLAKLCYDPDFEKLK
PEYLQALPEMLKLYSQFLGKQPWFLGDKITFVDFI
AYDVLERNQVFEPSCLDAFPNLKDFISRFE
Isotype
IgG
Antibody clone number
1E10
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -