Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN310222 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Glutathione S-Transferase mu 1 (GSTM1) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-GSTM1 antibody: synthetic peptide directed towards the N terminal of human GSTM1
- Reactivity
- Human, Mouse, Rat, Bovine, Canine
- Host
- Rabbit
- Antigen sequence
KKYTMGDAPDYDRSQWLNEKFKLGLDFPNLPYLID
GAHKI TQSNAILCYI- Vial size
- 50 µg
Submitted references MicroRNA regulation in Ames dwarf mouse liver may contribute to delayed aging.
Interaction of passive smoking with GST (GSTM1, GSTT1, and GSTP1) genotypes in the risk of cervical cancer in India.
Bates DJ, Li N, Liang R, Sarojini H, An J, Masternak MM, Bartke A, Wang E
Aging cell 2010 Feb;9(1):1-18
Aging cell 2010 Feb;9(1):1-18
Interaction of passive smoking with GST (GSTM1, GSTT1, and GSTP1) genotypes in the risk of cervical cancer in India.
Sobti RC, Kaur S, Kaur P, Singh J, Gupta I, Jain V, Nakahara A
Cancer genetics and cytogenetics 2006 Apr 15;166(2):117-23
Cancer genetics and cytogenetics 2006 Apr 15;166(2):117-23
No comments: Submit comment
No validations: Submit validation data