ABIN630167

antibody from antibodies-online

Targeting: ASPN FLJ20129, PLAP-1, SLRR1C

Western blot

Immunohistochemistry

Antibody data

Submit

Validation data

Product number: ABIN630167 - Provider product page
Provider: antibodies-online
Product name: anti-Asporin (ASPN) (Middle Region) antibody
Antibody type: Polyclonal
Antigen: Asporin antibody was raised using the middle region of ASPN corresponding to a region with amino acids NKISTVELEDFKRYKELQRLGLGNNKITDIENGSLANIPRVREIHLENNK
Description: Purified
Reactivity: Human, Rat
Host: Rabbit
Epitope: Middle Region
Vial size: 100 μg
Concentration: 1 mg/mL
Storage: Store at 2-8°C for short periods. For longer periods of storage, store at -20°C.
Handling: Avoid repeated freeze/thaw cycles. Dilute only prior to immediate use.

ASPN protein structure - ABIN630167 shown in red.