Antibody data
- Antibody Data
- Antigen structure
- References [4]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA008435 - Provider product page
- Provider
- Atlas Antibodies
- Product name
- Anti-ASPN
- Antibody type
- Polyclonal
- Antigen
- Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
- Description
- Affinity purified using the PrEST antigen as affinity ligand
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
IPLNLPKSLAELRIHENKVKKIQKDTFKGMNALHV
LEMSANPLDNNGIEPGAFEGVTVFHIRIAEAKLTS
VPKGLPPTLLELHLDYNKISTVELEDFKRYKELQR
LGLGNNKITDIENGSLAN- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage (1-2 days). Long time storage is recommended at -20°C. If stored at lower temperature, aliquot to avoid repeated freezing and thawing. Working dilution samples should be discarded if not used within 12 hours.
Submitted references Cancer‐associated fibroblasts educate normal fibroblasts to facilitate cancer cell spreading and T‐cell suppression
Asporin is a stromally expressed marker associated with prostate cancer progression
The dual role of asporin in breast cancer progression
Asporin Is a Fibroblast-Derived TGF-β1 Inhibitor and a Tumor Suppressor Associated with Good Prognosis in Breast Cancer
Itoh G, Takagane K, Fukushi Y, Kuriyama S, Umakoshi M, Goto A, Yanagihara K, Yashiro M, Tanaka M
Molecular Oncology 2021;16(1):166-187
Molecular Oncology 2021;16(1):166-187
Asporin is a stromally expressed marker associated with prostate cancer progression
Rochette A, Boufaied N, Scarlata E, Hamel L, Brimo F, Whitaker H, Ramos-Montoya A, Neal D, Dragomir A, Aprikian A, Chevalier S, Thomson A
British Journal of Cancer 2017;116(6):775-784
British Journal of Cancer 2017;116(6):775-784
The dual role of asporin in breast cancer progression
Simkova D, Kharaishvili G, Korinkova G, Ozdian T, Suchánková-Kleplová T, Soukup T, Krupka M, Galandakova A, Dzubak P, Janikova M, Navratil J, Kahounova Z, Soucek K, Bouchal J
Oncotarget 2016;7(32):52045-52060
Oncotarget 2016;7(32):52045-52060
Asporin Is a Fibroblast-Derived TGF-β1 Inhibitor and a Tumor Suppressor Associated with Good Prognosis in Breast Cancer
Kemp C, Maris P, Blomme A, Palacios A, Costanza B, Bellahcène A, Bianchi E, Gofflot S, Drion P, Trombino G, Di Valentin E, Cusumano P, Maweja S, Jerusalem G, Delvenne P, Lifrange E, Castronovo V, Turtoi A
PLOS Medicine 2015;12(9):e1001871
PLOS Medicine 2015;12(9):e1001871
No comments: Submit comment
No validations: Submit validation data