HPA008435

ASPN antibody from Sigma-Aldrich
FLJ20129, PLAP1, SLRR1C
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA008435
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA008435, RRID:AB_1845112
Product name
Anti-ASPN antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA008435
Antibody type
Polyclonal
Antigen
Asporin precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
IPLNLPKSLAELRIHENKVKKIQKDTFKGMNALHV
LEMSANPLDNNGIEPGAFEGVTVFHIRIAEAKLTS
VPKGLPPTLLELHLDYNKISTVELEDFKRYKELQR
LGLGNNKITDIENGSLAN
Storage
-20C
Provider Type Product Number
- No reagents -