Antibody data

Product number
H00011085-A01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00011085-A01, RRID:AB_489493
Product name
ADAM30 polyclonal antibody (A01)
Provider product page
Abnova Corporation - H00011085-A01
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a partial recombinant ADAM30.
Antigen sequence
YKHPKYLELILLFDQSRYRFVNNNLSQVIHDAILL
TGIMDTYFQDVRMRIHLKALEVWTDFNKIRVGYPE
LAEVLGRFVIYKKSVLNARLSSDWAHLYLQ
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -