Antibody data

Product number
ABIN311213
Provider
antibodies-online
Product name
anti-ADAM Metallopeptidase Domain 30 (ADAM30) (N-Term) antibody
Provider product page
antibodies-online - ABIN311213
Antibody type
Polyclonal
Antigen
The immunogen for anti-ADAM30 antibody: synthetic peptide directed towards the N terminal of human ADAM30
Description
Protein A purified
Reactivity
Human, Canine
Host
Rabbit
Antigen sequence
RLLLPRHLRVFSFTEHGELLEDHPYIPKDCNYMGS
VKESL DSKATISTCM
Epitope
N-Term
Vial size
100 μg
Concentration
1mg/mL
Storage
-20°C
Handling
Avoid repeated freeze-thaw cycles.
Provider Type Product Number
- No reagents -