AV49661

ADAM30 antibody from MilliporeSigma / Merck KGaA
svph4
No application information provided.

Antibody data

Product number
AV49661
Provider
MilliporeSigma / Merck KGaA
Product name
Anti-ADAM30 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - AV49661
Antibody type
Polyclonal
Antigen
synthetic peptide corresponding to a region of human ADAM30 with an internal ID of P29244
Description
IgG fraction of antiserum
Reactivity
Human
Antigen sequence
KHVLHLWPKRLLLPRHLRVFSFTEHGELLEDHPYI
PKDCNYMGSVKESLD
Storage
-20C