AV49661

ADAM30 antibody from Sigma-Aldrich
svph4
No application information provided.

Antibody data

Product number
AV49661
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#AV49661, RRID:AB_1844580
Product name
Anti-ADAM30 antibody produced in rabbit
Provider product page
Sigma-Aldrich - AV49661
Antibody type
Polyclonal
Antigen
synthetic peptide corresponding to a region of human ADAM30 with an internal ID of P29244
Description
IgG fraction of antiserum
Reactivity
Human
Antigen sequence
KHVLHLWPKRLLLPRHLRVFSFTEHGELLEDHPYI
PKDCNYMGSVKESLD
Storage
-20C
Provider Type Product Number
- No reagents -