HPA026080

ADAM30 antibody from MilliporeSigma / Merck KGaA
svph4
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA026080
Provider
MilliporeSigma / Merck KGaA
Product name
Anti-ADAM30 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA026080
Antibody type
Polyclonal
Antigen
ADAM 30 Precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
RCFRKGCRSRYMQCQSIFGPDAMEAPSECYDAVNL
IGDQFGNCEITGIRNFKKCESANSICGRLQCINVE
TIPDLPEHTTIISTHLQAENLMCWGTGYHLSMKPM
GIPDLGMINDGTSCG
Storage
-20C