Explore
Validate
Learn
Western blotAntibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN1109499 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Vacuolar Protein Sorting 72 Homolog (S. Cerevisiae) (VPS72) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-TCFL1 antibody: synthetic peptide directed towards the middle region of human TCFL1
- Description
- Purified using peptide immunoaffinity column
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Rabbit, Xenopus, Zebrafish
- Host
- Rabbit
- Antigen sequence
TEELNLRSLETYERLEADKKKQVHKKRKCPGPIIT
YHSVTVPLVGEPGPK- Epitope
- Middle Region
- Vial size
- 50 μg
- Storage
- Store lyophilized at 2-8°C or at -20°C long term. After reconstitution store the antibody undiluted at 2-8°C for up to one month or in aliquots at -20°C long term.
- Handling
- Avoid repeated freezing and thawing.
Submitted references Molecular cloning of a novel human cDNA on chromosome 1q21 and its mouse homolog encoding a nuclear protein with DNA-binding ability.
Horikawa I, Tanaka H, Yuasa Y, Suzuki M, Oshimura M
Biochemical and biophysical research communications 1995 Mar 28;208(3):999-1007
Biochemical and biophysical research communications 1995 Mar 28;208(3):999-1007
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Human Lung; WB Suggested Anti-TCFL1 Antibody Titration: 0.06ug/ml. Positive Control: Human Lung; TCFL1 antibody - middle region (AP42255PU-N) in Human Lung cells using Western Blot
