HPA008462

TDRP antibody from Sigma-Aldrich
C8orf42, INM01, TDRP1, TDRP2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA008462
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA008462, RRID:AB_1845777
Product name
Anti-C8orf42 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA008462
Antibody type
Polyclonal
Antigen
Uncharacterized protein C8orf42 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
AQVQGASFRGWKEVTSLFNKDDEQHLLERCKSPKS
KGTNLRLKEELKAEKKSGFWDNLVLKQNIQSKKPD
EIEGWEPPKLALEDISADPEDTVGGHPSWSGWEDD
AKGSTKYTSLASSANSSRWSLRAAGRLVSIRRQSK
GHLTDSPEEA
Storage
-20C
Provider Type Product Number
- No reagents -