HPA007164

DMPK antibody from Atlas Antibodies
DM, DM1, DM1PK, DMK, MDPK, MT-PK
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA007164
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA007164, RRID:AB_1078687
Product name
Anti-DMPK
Provider product page
Atlas Antibodies - HPA007164
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
SDIREGAPLGVHLPFVGYSYSCMALRDSEVPGPTP
MELEAEQLLEPHVQAPSLEPSVSPQDETAEVAVPA
AVPAAEAEAEVTLRELQEALEEEVLTRQSLSREME
AIRTDNQNFASQLREAEARNRDLEAHVRQLQERME
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -