HPA008905

DMPK antibody from Atlas Antibodies
DM, DM1, DM1PK, DMK, MDPK, MT-PK

Antibody data

Product number
HPA008905
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA008905, RRID:AB_1078685
Product name
Anti-DMPK
Provider product page
Atlas Antibodies - HPA008905
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
LGVFAYEMFYGQTPFYADSTAETYGKIVHYKEHLS
LPLVDEGVPEEARDFIQRLLCPPETRLGRGGAGDF
RTHPFFFGLDWDGLRDSVPPFTPDFEGATDTCNFD
LVE
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.