HPA007164

DMPK antibody from Sigma-Aldrich
DM, DM1, DM1PK, DMK, MDPK, MT-PK
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA007164
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA007164, RRID:AB_1078687
Product name
Anti-DMPK antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA007164
Antibody type
Polyclonal
Antigen
Myotonin-protein kinase recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SDIREGAPLGVHLPFVGYSYSCMALRDSEVPGPTP
MELEAEQLLEPHVQAPSLEPSVSPQDETAEVAVPA
AVPAAEAEAEVTLRELQEALEEEVLTRQSLSREME
AIRTDNQNFASQLREAEARNRDLEAHVRQLQERME
Storage
-20C
Provider Type Product Number
- No reagents -