HPA008905

DMPK antibody from Sigma-Aldrich
DM, DM1, DM1PK, DMK, MDPK, MT-PK
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA008905
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA008905, RRID:AB_1078685
Product name
Anti-DMPK antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA008905
Antibody type
Polyclonal
Antigen
Myotonin-protein kinase recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LGVFAYEMFYGQTPFYADSTAETYGKIVHYKEHLS
LPLVDEGVPEEARDFIQRLLCPPETRLGRGGAGDF
RTHPFFFGLDWDGLRDSVPPFTPDFEGATDTCNFD
LVE
Storage
-20C
Provider Type Product Number
- No reagents -