Antibody data

Product number
ABIN786429
Provider
antibodies-online
Product name
anti-Glucokinase (Hexokinase 4) (GCK) (N-Term) antibody
Provider product page
antibodies-online - ABIN786429
Antibody type
Polyclonal
Antigen
Other
Reactivity
Human
Host
Rabbit
Antigen sequence
RVMLVKVGEGEEGQWSVKTKHQMYSIPEDAMTGTA
EMLFD YISECISDFL
Epitope
N-Term
Vial size
50 μg
Concentration
1mg/mL
Storage
-20°C
Handling
Avoid repeated freeze-thaw cycles.
Provider Type Product Number
- No reagents -