HPA007093

GCK antibody from Atlas Antibodies
HK4, MODY2
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA007093
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA007093, RRID:AB_888432
Product name
Anti-GCK
Provider product page
Atlas Antibodies - HPA007093
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
DLGGTNFRVMLVKVGEGEEGQWSVKTKHQMYSIPE
DAMTGTAEMLFDYISECISDFLDKHQMKHKKLPLG
FTFSFPVRHEDIDKGILLNWTKGFKASGAEGNNVV
GLLRDAIK
Isotype
IgG
Vial size
100 µl
Storage
Store at +4¡C for short term storage. Long time storage is recommended at -20¡C.
Provider Type Product Number
- No reagents -