HPA007034

GCK antibody from Sigma-Aldrich
HK4, MODY2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA007034
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA007034, RRID:AB_1079050
Product name
Anti-GCK antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA007034
Antibody type
Polyclonal
Antigen
Glucokinase recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
RLVDENLLFHGEASEQLRTRGAFETRFVSQVESDT
GDRKQIYNILSTLGLRPSTTDCDIVRRACESVSTR
AAHMCSAGLAGVINRMRESRSEDVMRITVGVDGSV
YKLHPSFKERFHA
Storage
-20C
Provider Type Product Number
- No reagents -