H00007010-M20

TEK antibody from Abnova Corporation
CD202b, TIE-2, TIE2, VMCM, VMCM1

Antibody data

Product number
H00007010-M20
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00007010-M20, RRID:AB_1205064
Product name
TEK monoclonal antibody (M20), clone 3A5
Provider product page
Abnova Corporation - H00007010-M20
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant TEK.
Antigen sequence
NQHQDPLEVTQDVTREWAKKVVWKREKASKINGAY
FCEGRVRGEAIRIRTMKMRQQASFLPATLTMTVDK
GDNVNISFKKVLIKEEDAVIYKNGSFIHSVPRHEV
PDILEVHLPHAQPQD*
Isotype
IgG
Antibody clone number
3A5
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -