HPA011738

TEK antibody from MilliporeSigma / Merck KGaA
CD202b, TIE-2, TIE2, VMCM, VMCM1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA011738
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA011738, RRID:AB_1846266
Product name
Anti-TEK antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA011738
Antibody type
Polyclonal
Antigen
Angiopoietin-1 receptor precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
EPITIGRDFEALMNQHQDPLEVTQDVTREWAKKVV
WKREKASKINGAYFCEGRVRGEAIRIRTMKMRQQA
SFLPATLTMTVDKGDNVNISFKKVLIKEEDAVIYK
NGSFIHSVPRHEVPDIL
Storage
-20C
Provider Type Product Number
- No reagents -