Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- PAB29437 - Provider product page

- Provider
- Abnova Corporation
- Product name
- NR1I3 polyclonal antibody
- Antibody type
- Polyclonal
- Antigen
- Recombinant protein corresponding to human NR1I3.
- Reactivity
- Human
- Host
- Rabbit
- Antigen sequence
DAGMRKDMILSAEALALRRAKQAQRRAQQTPVQLS
KEQEELIRTLLGAHTRHMGTMFEQFVQFRPPAHLF
IHHQP- Isotype
- IgG
- Vial size
- 100 μl
- Storage
- Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescent staining of human cell line MCF7 with NR1I3 polyclonal antibody (Cat # PAB29437) at 1-4 ug/mL concentration shows positivity in nucleus but excluded from the nucleoli.
- Validation comment
- Immunofluorescence
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunohistochemical staining of human bronchus with NR1I3 polyclonal antibody (Cat # PAB29437) shows moderate nuclear positivity in respiratory epithelial cells at 1:50-1:200 dilution.
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)