HPA007097

PTPN12 antibody from Sigma-Aldrich
PTP-PEST, PTPG1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA007097
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA007097, RRID:AB_1079689
Product name
Anti-PTPN12 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA007097
Antibody type
Polyclonal
Antigen
Tyrosine-protein phosphatase non-receptor type 12 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SVTQSNKVSVTPPEESQNSDTPPRPDRLPLDEKGH
VTWSFHGPENAIPIPDLSEGNSSDINYQTRKTVSL
TPSPTTQVETPDLVDHDNTSPLFRTPLSFTNPLHS
DDSDSDERNSDGAVTQNKTNISTASATVSAAT
Storage
-20C
Provider Type Product Number
- No reagents -