Antibody data
- Antibody Data
- Antigen structure
- References [4]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA030088 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA030088, RRID:AB_10601106
- Product name
- Anti-LMX1A
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
QRAKMKKLARRQQQQQQDQQNTQRLSSAQTNGGGS
AGMEGIMNPYTALPTPQQLLAIEQSVYSSDPFRQG
LT- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Protocol for fabricating elastomeric stencils for patterned stem cell differentiation
Azoramide protects iPSC-derived dopaminergic neurons with PLA2G6 D331Y mutation through restoring ER function and CREB signaling
Charting cellular identity during human in vitro β-cell differentiation
Dopaminergic control of autophagic-lysosomal function implicates Lmx1b in Parkinson's disease
Lehr S, Merrin J, Kulig M, Minchington T, Kicheva A
STAR Protocols 2024;5(4):103187
STAR Protocols 2024;5(4):103187
Azoramide protects iPSC-derived dopaminergic neurons with PLA2G6 D331Y mutation through restoring ER function and CREB signaling
Ke M, Chong C, Zeng H, Huang M, Huang Z, Zhang K, Cen X, Lu J, Yao X, Qin D, Su H
Cell Death & Disease 2020;11(2)
Cell Death & Disease 2020;11(2)
Charting cellular identity during human in vitro β-cell differentiation
Veres A, Faust A, Bushnell H, Engquist E, Kenty J, Harb G, Poh Y, Sintov E, Gürtler M, Pagliuca F, Peterson Q, Melton D
Nature 2019;569(7756):368-373
Nature 2019;569(7756):368-373
Dopaminergic control of autophagic-lysosomal function implicates Lmx1b in Parkinson's disease
Laguna A, Schintu N, Nobre A, Alvarsson A, Volakakis N, Jacobsen J, Gómez-Galán M, Sopova E, Joodmardi E, Yoshitake T, Deng Q, Kehr J, Ericson J, Svenningsson P, Shupliakov O, Perlmann T
Nature Neuroscience 2015;18(6):826-835
Nature Neuroscience 2015;18(6):826-835
No comments: Submit comment
No validations: Submit validation data