Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN183582 - Provider product page

- Provider
- antibodies-online
- Product name
- anti-LIM Homeobox Transcription Factor 1, alpha (LMX1A) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-LMX1A antibody: synthetic peptide corresponding to a region of Mouse
- Reactivity
- Human, Mouse, Rat, Chicken/Avian
- Host
- Rabbit
- Antigen sequence
AIEQSVYNSDPFRQGLTPPQMPGDHMHPYGAEPLF
HDLDS DDTSLSNLGD- Vial size
- 0.1 mg
Submitted references Antisense transcription in the mammalian transcriptome.
Katayama S, Tomaru Y, Kasukawa T, Waki K, Nakanishi M, Nakamura M, Nishida H, Yap CC, Suzuki M, Kawai J, Suzuki H, Carninci P, Hayashizaki Y, Wells C, Frith M, Ravasi T, Pang KC, Hallinan J, Mattick J, Hume DA, Lipovich L, Batalov S, Engström PG, Mizuno Y, Faghihi MA, Sandelin A, Chalk AM, Mottagui-Tabar S, Liang Z, Lenhard B, Wahlestedt C, RIKEN Genome Exploration Research Group, Genome Science Group (Genome Network Project Core Group), FANTOM Consortium
Science (New York, N.Y.) 2005 Sep 2;309(5740):1564-6
Science (New York, N.Y.) 2005 Sep 2;309(5740):1564-6
No comments: Submit comment
No validations: Submit validation data