ABIN631217

antibody from antibodies-online

Targeting: KHK

Western blot

Immunohistochemistry

Antibody data

Submit

Validation data

Product number: ABIN631217 - Provider product page
Provider: antibodies-online
Product name: anti-Ketohexokinase (KHK) antibody
Antibody type: Polyclonal
Antigen: KHK antibody was raised using a synthetic peptide corresponding to a region with amino acids FQSAEEALRGLYGRVRKGAVLVCAWAEEGADALGPDGKLLHSDAFPPPRV
Description: Affinity purified
Reactivity: Human
Host: Rabbit
Vial size: 50 μg
Concentration: 1 mg/mL
Storage: Store at 2-8°C for short periods. For longer periods of storage, store at -20°C.
Handling: Avoid repeated freeze/thaw cycles.

KHK protein structure - ABIN631217 shown in red.