Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00009448-M07 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00009448-M07, RRID:AB_530126
- Product name
- MAP4K4 monoclonal antibody (M07), clone 4A5
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant MAP4K4.
- Antigen sequence
VHPALQRPAEPQVQWSHLASLKNNVSPVSRSHSFS
DPSPKFAHHHLRSQDPCPPSRSEVLSQSSDSKSEA
PDPTQKAWSRSDSDEVPPRVPVRTTSRSPV- Isotype
- IgG
- Antibody clone number
- 4A5
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Intracellular Theileria annulata promote invasive cell motility through kinase regulation of the host actin cytoskeleton.
Filopodia and membrane blebs drive efficient matrix invasion of macrophages transformed by the intracellular parasite Theileria annulata.
Ma M, Baumgartner M
PLoS pathogens 2014 Mar;10(3):e1004003
PLoS pathogens 2014 Mar;10(3):e1004003
Filopodia and membrane blebs drive efficient matrix invasion of macrophages transformed by the intracellular parasite Theileria annulata.
Ma M, Baumgartner M
PloS one 2013;8(9):e75577
PloS one 2013;8(9):e75577
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- MAP4K4 monoclonal antibody (M07), clone 4A5 Western Blot analysis of MAP4K4 expression in K-562 ( Cat # L009V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged MAP4K4 is approximately 0.03ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunoperoxidase of monoclonal antibody to MAP4K4 on formalin-fixed paraffin-embedded human breast cancer. [antibody concentration 3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol