HPA008476

MAP4K4 antibody from Atlas Antibodies
FLH21957, HGK, NIK
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA008476
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA008476, RRID:AB_1079362
Product name
Anti-MAP4K4
Provider product page
Atlas Antibodies - HPA008476
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
AEPQVQWSHLASLKNNVSPVSRSHSFSDPSPKFAH
HHLRSQDPCPPSRSEVLSQSSDSKSEAPDPTQKAW
SRSDSDEVPPRVPVRTTSRSPVLSRRDSPLQGSGQ
QNSQAGQRNSTSSI
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -