HPA008476

MAP4K4 antibody from Sigma-Aldrich
FLH21957, HGK, NIK
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA008476
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA008476, RRID:AB_1079362
Product name
Anti-MAP4K4 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA008476
Antibody type
Polyclonal
Antigen
Mitogen-activated protein kinase kinase kinase kinase 4 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
AEPQVQWSHLASLKNNVSPVSRSHSFSDPSPKFAH
HHLRSQDPCPPSRSEVLSQSSDSKSEAPDPTQKAW
SRSDSDEVPPRVPVRTTSRSPVLSRRDSPLQGSGQ
QNSQAGQRNSTSSI
Storage
-20C
Provider Type Product Number
- No reagents -