HPA007625

MAP3K4 antibody from Sigma-Aldrich
KIAA0213, MAPKKK4, MEKK4, MTK1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA007625
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA007625, RRID:AB_1853770
Product name
Anti-MAP3K4 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA007625
Antibody type
Polyclonal
Antigen
Mitogen-activated protein kinase kinase kinase 4 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
KDREQRGQENTSGFWLNRSNELIWLELQAWHAGRT
INDQDFFLYTARQAIPDIINEILTFKVDYGSFAFV
RDRAGFNGTSVEGQCKATPGTKIVGYSTHHEHLQR
QRVSFEQVKRIMELLEYIEALYPSLQ
Storage
-20C
Provider Type Product Number
- No reagents -