HPA019118

PTPN7 antibody from Sigma-Aldrich
HEPTP, LC-PTP
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA019118
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA019118, RRID:AB_1855755
Product name
Anti-PTPN7 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA019118
Antibody type
Polyclonal
Antigen
Tyrosine-protein phosphatase non-receptor type 7 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LIVMLTQLREGKEKCVHYWPTEEETYGPFQIRIQD
MKECPEYTVRQLTIQYQEERRSVKHILFSAWPDHQ
TPESAGPLLRLVAEVEESPETAAHPGPIVVHCSAG
IGRTGCFIATRIGCQQLKARGEVDILGIVCQL
Storage
-20C
Provider Type Product Number
- No reagents -