Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA071245 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA071245, RRID:AB_2686371
- Product name
- Anti-TYRO3
- Antibody type
- Polyclonal
- Description
- Affinity purified using the PrEST antigen as affinity ligand
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
RPSFTCLRMELENILGQLSVLSASQDPLYINIERA
EEPTAGGSLELPGRDQPYSGAGDGSGMGAVGGTPS
DCRY- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references TYRO3 promotes chemoresistance via increased LC3 expression in pancreatic cancer
TYRO3 as a molecular target for growth inhibition and apoptosis induction in bladder cancer
Hara K, Horikoshi Y, Morimoto M, Nakaso K, Sunaguchi T, Kurashiki T, Nakayama Y, Hanaki T, Yamamoto M, Sakamoto T, Fujiwara Y, Matsura T
Translational Oncology 2023;28
Translational Oncology 2023;28
TYRO3 as a molecular target for growth inhibition and apoptosis induction in bladder cancer
Dufour F, Silina L, Neyret-Kahn H, Moreno-Vega A, Krucker C, Karboul N, Dorland-Galliot M, Maillé P, Chapeaublanc E, Allory Y, Stransky N, Haegel H, Menguy T, Duong V, Radvanyi F, Bernard-Pierrot I
British Journal of Cancer 2019;120(5):555-564
British Journal of Cancer 2019;120(5):555-564
No comments: Submit comment
No validations: Submit validation data