HPA007654

TYRO3 antibody from Sigma-Aldrich
Brt, Dtk, Etk-2, Rek, RSE, Sky, Tif
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA007654
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA007654, RRID:AB_1078708
Product name
Anti-TYRO3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA007654
Antibody type
Polyclonal
Antigen
Tyrosine-protein kinase receptor TYRO3 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VRCANALGPSPYADWVPFQTKGLAPASAPQNLHAI
RTDSGLILEWEEVIPEAPLEGPLGPYKLSWVQDNG
TQDELTVEGTRANLTGWDPQKDLIVRVCVSNAVGC
GPWSQPLVV
Storage
-20C
Provider Type Product Number
- No reagents -