HPA018919

MDM4 antibody from Sigma-Aldrich
HDMX, MDMX
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA018919
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA018919, RRID:AB_1853694
Product name
Anti-MDM4 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA018919
Antibody type
Polyclonal
Antigen
Protein Mdm4 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SFSVKDPSPLYDMLRKNLVTLATATTDAAQTLALA
QDHSMDIPSQDQLKQSAEESSTSRKRTTEDDIPTL
P
Storage
-20C
Provider Type Product Number
- No reagents -