HPA007982

ACVR1C antibody from Atlas Antibodies
ACVRLK7, ALK7
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA007982
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA007982, RRID:AB_1078134
Product name
Anti-ACVR1C
Provider product page
Atlas Antibodies - HPA007982
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
ELSPGLKCVCLLCDSSNFTCQTEGACWASVMLTNG
KEQVIKSCVSLPELNAQVFCHSSNNVTKTECCFTD
FCNNITLHL
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -