HPA011933

ACVR1C antibody from Sigma-Aldrich
ACVRLK7, ALK7
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA011933
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA011933, RRID:AB_1844754
Product name
Anti-ACVR1C antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA011933
Antibody type
Polyclonal
Antigen
Activin receptor type-1C precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VGTQGKPAIAHRDIKSKNILVKKCETCAIADLGLA
VKHDSILNTIDIPQNPKVGTKRYMAPEMLDDTMNV
NIFESFKRADIYSVGLVYWEIARRC
Storage
-20C
Provider Type Product Number
- No reagents -