Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00007044-M03 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00007044-M03, RRID:AB_1237765
- Product name
- LEFTY2 monoclonal antibody (M03), clone 1D10
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant LEFTY2.
- Antigen sequence
RFSQSFREVAGRFLASEASTHLLVFGMEQRLPPNS
ELVQAVLRLFQEPVPKAALHRHGRLSPRSAQARVT
VEWLRVRDDGSNRTSLIDSRLVSVHESGWKAFDV- Isotype
- IgG
- Antibody clone number
- 1D10
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
No validations: Submit validation data