H00007044-M03

LEFTY2 antibody from Abnova Corporation
EBAF, LEFTA, LEFTYA, TGFB4
No application information provided.

Antibody data

Product number
H00007044-M03
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00007044-M03, RRID:AB_1237765
Product name
LEFTY2 monoclonal antibody (M03), clone 1D10
Provider product page
Abnova Corporation - H00007044-M03
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant LEFTY2.
Antigen sequence
RFSQSFREVAGRFLASEASTHLLVFGMEQRLPPNS
ELVQAVLRLFQEPVPKAALHRHGRLSPRSAQARVT
VEWLRVRDDGSNRTSLIDSRLVSVHESGWKAFDV
Isotype
IgG
Antibody clone number
1D10
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -