HPA007459

ROCK2 antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA007459
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA007459, RRID:AB_1079828
Product name
Anti-ROCK2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA007459
Antibody type
Polyclonal
Antigen
ρ-Associated protein kinase 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
FVGNQLPFIGFTYYRENLLLSDSPSCRETDSIQSR
KNEESQEIQKKLYTLEEHLSNEMQAKEELEQKCKS
VNTRLEKTAKELEEEITLRKSVESALRQLEREKAL
LQHKNAEYQRKADHEADK
Storage
-20C
Provider Type Product Number
- No reagents -