HPA027438

EXOC8 antibody from Atlas Antibodies
EXO84, Exo84p, SEC84
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA027438
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA027438, RRID:AB_1848318
Product name
Anti-EXOC8
Provider product page
Atlas Antibodies - HPA027438
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
RDHLRGQAGFFSTPGGASRDGSGPGEEGKQRTLTT
LLEKVEGCRHLLETPGQYLVYNGDLVEYDADHMAQ
LQRVHGFLMNDCLLVATWLPQRRGMYRYNAL
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -