H00023097-M03

CDK19 antibody from Abnova Corporation
bA346C16.3, CDC2L6, CDK11, KIAA1028

Antibody data

Product number
H00023097-M03
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00023097-M03, RRID:AB_1137125
Product name
CDC2L6 monoclonal antibody (M03), clone 2C6
Provider product page
Abnova Corporation - H00023097-M03
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant CDC2L6.
Antigen sequence
MDYDFKAKLAAERERVEDLFEYEGCKVGRGTYGHV
YKARRKDGKDEKEYALKQIEGTGISMSACREIALL
RELKHPNVIALQKVFLSHSDRKVWLLFDYAEHDLW
HIIKFHRAS
Isotype
IgG
Antibody clone number
2C6
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -