H00023097-M01

CDK19 antibody from Abnova Corporation
bA346C16.3, CDC2L6, CDK11, KIAA1028

Antibody data

Product number
H00023097-M01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00023097-M01, RRID:AB_1137127
Product name
CDC2L6 monoclonal antibody (M01), clone 3D7
Provider product page
Abnova Corporation - H00023097-M01
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant CDC2L6.
Antigen sequence
MDYDFKAKLAAERERVEDLFEYEGCKVGRGTYGHV
YKARRKDGKDEKEYALKQIEGTGISMSACREIALL
RELKHPNVIALQKVFLSHSDRKVWLLFDYAEHDLW
HIIKFHRAS
Isotype
IgG
Antibody clone number
3D7
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -