Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- Immunocytochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00023097-M06 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00023097-M06, RRID:AB_10905148
- Product name
- CDC2L6 monoclonal antibody (M06), clone 8B6
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant CDC2L6.
- Antigen sequence
KGDKNQQQQQNQHQQPTAPPQQAAAPPQAPPPQQN
STQTNGTAGGAGAGVGGTGAGLQHSQDSSLNQVPP
NKKPRLGPSGANSGGPVMPSDYQHSSSRLNY- Isotype
- IgG
- Antibody clone number
- 8B6
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of CDC2L6 expression in transfected 293T cell line by CDC2L6 monoclonal antibody (M06), clone 8B6.Lane 1: CDC2L6 transfected lysate (Predicted MW: 56.8 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of monoclonal antibody to CDC2L6 on HeLa cell . [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol