HPA007053

CDK19 antibody from Sigma-Aldrich
bA346C16.3, CDC2L6, CDK11, KIAA1028
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA007053
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA007053, RRID:AB_1846369
Product name
Anti-CDC2L6 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA007053
Antibody type
Polyclonal
Antigen
Cell division cycle 2-like protein kinase 6 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
KGDKNQQQQQNQHQQPTAPPQQAAAPPQAPPPQQN
STQTNGTAGGAGAGVGGTGAGLQHSQDSSLNQVPP
NKKPRLGPSGANSGGPVMPSDYQHSSSRLNYQSSV
QGSSQSQSTLGYSSSSQQSSQYHPSH
Storage
-20C
Provider Type Product Number
- No reagents -