Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN503968 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Mitogen-Activated Protein Kinase 1/3 (MAPK1/3) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-MAPK13 antibody: synthetic peptide directed towards the middle region of human MAPK13
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat
- Host
- Rabbit
- Antigen sequence
KMLELDVDKRLTAAQALTHPFFEPFRDPEEETEAQ
QPFDD SLEHEKLTVD- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references MKP-1 inhibits high NaCl-induced activation of p38 but does not inhibit the activation of TonEBP/OREBP: opposite roles of p38alpha and p38delta.
Zhou X, Ferraris JD, Dmitrieva NI, Liu Y, Burg MB
Proceedings of the National Academy of Sciences of the United States of America 2008 Apr 8;105(14):5620-5
Proceedings of the National Academy of Sciences of the United States of America 2008 Apr 8;105(14):5620-5
No comments: Submit comment
No validations: Submit validation data